ATP6V0A2 polyclonal antibody (A01)
  • ATP6V0A2 polyclonal antibody (A01)

ATP6V0A2 polyclonal antibody (A01)

Ref: AB-H00023545-A01
ATP6V0A2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ATP6V0A2.
Información adicional
Size 50 uL
Gene Name ATP6V0A2
Gene Alias ARCL|ATP6N1D|ATP6a2|J6B7|Stv1|TJ6|TJ6M|TJ6s|Vph1|WSS|a2
Gene Description ATPase, H+ transporting, lysosomal V0 subunit a2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GYTIVSYAELDESLEDPETGEVIKWYVFLISFWGEQIGHKVKKICDCYHCHVYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQVLCKAAESVYSRVIQVKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATP6V0A2 (NP_036595, 198 a.a. ~ 304 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23545

Enviar uma mensagem


ATP6V0A2 polyclonal antibody (A01)

ATP6V0A2 polyclonal antibody (A01)