SEC14L2 monoclonal antibody (M05), clone 2E5
  • SEC14L2 monoclonal antibody (M05), clone 2E5

SEC14L2 monoclonal antibody (M05), clone 2E5

Ref: AB-H00023541-M05
SEC14L2 monoclonal antibody (M05), clone 2E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SEC14L2.
Información adicional
Size 100 ug
Gene Name SEC14L2
Gene Alias C22orf6|KIAA1186|KIAA1658|MGC65053|SPF|TAP|TAP1
Gene Description SEC14-like 2 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq DIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEC14L2 (NP_036561.1, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23541
Clone Number 2E5
Iso type IgG2a Kappa

Enviar uma mensagem


SEC14L2 monoclonal antibody (M05), clone 2E5

SEC14L2 monoclonal antibody (M05), clone 2E5