PRAME purified MaxPab rabbit polyclonal antibody (D01P)
  • PRAME purified MaxPab rabbit polyclonal antibody (D01P)

PRAME purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023532-D01P
PRAME purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRAME protein.
Información adicional
Size 100 ug
Gene Name PRAME
Gene Alias MAPE|OIP4
Gene Description preferentially expressed antigen in melanoma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAAFDGRHSQTLKAMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPTLAKFSPY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRAME (NP_006106.1, 1 a.a. ~ 509 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23532

Enviar uma mensagem


PRAME purified MaxPab rabbit polyclonal antibody (D01P)

PRAME purified MaxPab rabbit polyclonal antibody (D01P)