CLCF1 monoclonal antibody (M01A), clone 7E10
  • CLCF1 monoclonal antibody (M01A), clone 7E10

CLCF1 monoclonal antibody (M01A), clone 7E10

Ref: AB-H00023529-M01A
CLCF1 monoclonal antibody (M01A), clone 7E10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CLCF1.
Información adicional
Size 200 uL
Gene Name CLCF1
Gene Alias BSF3|CISS2|CLC|NNT1|NR6
Gene Description cardiotrophin-like cytokine factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLCF1 (AAH12939, 29 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 23529
Clone Number 7E10
Iso type IgM Kappa

Enviar uma mensagem


CLCF1 monoclonal antibody (M01A), clone 7E10

CLCF1 monoclonal antibody (M01A), clone 7E10