CLCF1 purified MaxPab mouse polyclonal antibody (B03P)
  • CLCF1 purified MaxPab mouse polyclonal antibody (B03P)

CLCF1 purified MaxPab mouse polyclonal antibody (B03P)

Ref: AB-H00023529-B03P
CLCF1 purified MaxPab mouse polyclonal antibody (B03P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CLCF1 protein.
Información adicional
Size 50 ug
Gene Name CLCF1
Gene Alias BSF3|CISS2|CLC|NNT1|NR6
Gene Description cardiotrophin-like cytokine factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CLCF1 (NP_037378.1, 1 a.a. ~ 225 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23529

Enviar uma mensagem


CLCF1 purified MaxPab mouse polyclonal antibody (B03P)

CLCF1 purified MaxPab mouse polyclonal antibody (B03P)