CENTB2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CENTB2 purified MaxPab rabbit polyclonal antibody (D01P)

CENTB2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023527-D01P
CENTB2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CENTB2 protein.
Información adicional
Size 100 ug
Gene Name ACAP2
Gene Alias CENTB2|CNT-B2|KIAA0041
Gene Description ArfGAP with coiled-coil, ankyrin repeat and PH domains 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFMNGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKFKDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQINVLQSKRRSEILKSMLSFMYAHLAFFHQGYDLFSELGPYMKDLGAQLDRLVVDAAKEKREMEQKHSTIQQKDFSSDDS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CENTB2 (NP_036419.2, 1 a.a. ~ 778 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23527

Enviar uma mensagem


CENTB2 purified MaxPab rabbit polyclonal antibody (D01P)

CENTB2 purified MaxPab rabbit polyclonal antibody (D01P)