POFUT1 purified MaxPab rabbit polyclonal antibody (D01P)
  • POFUT1 purified MaxPab rabbit polyclonal antibody (D01P)

POFUT1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023509-D01P
POFUT1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human POFUT1 protein.
Información adicional
Size 100 ug
Gene Name POFUT1
Gene Alias FUT12|KIAA0180|MGC2482|O-FUT|O-Fuc-T|O-FucT-1
Gene Description protein O-fucosyltransferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRRENHSCVTLLFPR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen POFUT1 (NP_758436.1, 1 a.a. ~ 194 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23509

Enviar uma mensagem


POFUT1 purified MaxPab rabbit polyclonal antibody (D01P)

POFUT1 purified MaxPab rabbit polyclonal antibody (D01P)