DAAM2 monoclonal antibody (M01), clone 1D8
  • DAAM2 monoclonal antibody (M01), clone 1D8

DAAM2 monoclonal antibody (M01), clone 1D8

Ref: AB-H00023500-M01
DAAM2 monoclonal antibody (M01), clone 1D8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant DAAM2.
Información adicional
Size 100 ug
Gene Name DAAM2
Gene Alias KIAA0381|MGC90515|dJ90A20A.1
Gene Description dishevelled associated activator of morphogenesis 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKKVPSLTPLATSQGSWHGVALAALACSCIHLMFITCQPCSRCWRNNSE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAAM2 (AAH47575.1, 1 a.a. ~ 132 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23500
Clone Number 1D8
Iso type IgG2a Kappa

Enviar uma mensagem


DAAM2 monoclonal antibody (M01), clone 1D8

DAAM2 monoclonal antibody (M01), clone 1D8