MACF1 polyclonal antibody (A01)
  • MACF1 polyclonal antibody (A01)

MACF1 polyclonal antibody (A01)

Ref: AB-H00023499-A01
MACF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MACF1.
Información adicional
Size 50 uL
Gene Name MACF1
Gene Alias ABP620|ACF7|FLJ45612|FLJ46776|KIAA0465|KIAA1251|MACF|OFC4
Gene Description microtubule-actin crosslinking factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MACF1 (AAH07330, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23499

Enviar uma mensagem


MACF1 polyclonal antibody (A01)

MACF1 polyclonal antibody (A01)