CBX7 purified MaxPab mouse polyclonal antibody (B01P)
  • CBX7 purified MaxPab mouse polyclonal antibody (B01P)

CBX7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023492-B01P
CBX7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CBX7 protein.
Información adicional
Size 50 ug
Gene Name CBX7
Gene Alias -
Gene Description chromobox homolog 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CBX7 (NP_783640.1, 1 a.a. ~ 251 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23492

Enviar uma mensagem


CBX7 purified MaxPab mouse polyclonal antibody (B01P)

CBX7 purified MaxPab mouse polyclonal antibody (B01P)