TGDS purified MaxPab rabbit polyclonal antibody (D01P)
  • TGDS purified MaxPab rabbit polyclonal antibody (D01P)

TGDS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023483-D01P
TGDS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TGDS protein.
Información adicional
Size 100 ug
Gene Name TGDS
Gene Alias SDR2E1|TDPGD
Gene Description TDP-glucose 4,6-dehydratase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSAACWEEPWGLPGGFAKRVLVTGGAGFIASHMIVSLVEDYPNYMIINLDKLDYCASLKNLETISNKQNYKFIQGDICDSHFVKLLFETEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVYGTHVLVSAAHEARVEKFIYVSTDEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITRSSNVYGPHQYPEKVIPKFISLLQHNRKCCIHGSGLQTRNFLYATDVVEAFLTVLKKGKPGEIY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TGDS (NP_055120.1, 1 a.a. ~ 350 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23483

Enviar uma mensagem


TGDS purified MaxPab rabbit polyclonal antibody (D01P)

TGDS purified MaxPab rabbit polyclonal antibody (D01P)