View larger
Mouse polyclonal antibody raised against a full-length human NIFUN protein.
AB-H00023479-B01P
New product
NIFUN purified MaxPab mouse polyclonal antibody (B01P)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | ISCU |
| Gene Alias | 2310020H20Rik|HML|ISU2|MGC74517|NIFU|NIFUN|hnifU |
| Gene Description | iron-sulfur cluster scaffold homolog (E. coli) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MVLIDMSVDLSTQVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | NIFUN (NP_055116, 1 a.a. ~ 142 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 23479 |
More info
Mouse polyclonal antibody raised against a full-length human NIFUN protein.