QPRT monoclonal antibody (M01), clone 5D11
  • QPRT monoclonal antibody (M01), clone 5D11

QPRT monoclonal antibody (M01), clone 5D11

Ref: AB-H00023475-M01
QPRT monoclonal antibody (M01), clone 5D11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant QPRT.
Información adicional
Size 100 ug
Gene Name QPRT
Gene Alias QPRTase
Gene Description quinolinate phosphoribosyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen QPRT (NP_055113, 198 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23475
Clone Number 5D11
Iso type IgG1 Kappa

Enviar uma mensagem


QPRT monoclonal antibody (M01), clone 5D11

QPRT monoclonal antibody (M01), clone 5D11