QPRT polyclonal antibody (A01)
  • QPRT polyclonal antibody (A01)

QPRT polyclonal antibody (A01)

Ref: AB-H00023475-A01
QPRT polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant QPRT.
Información adicional
Size 50 uL
Gene Name QPRT
Gene Alias QPRTase
Gene Description quinolinate phosphoribosyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen QPRT (NP_055113, 198 a.a. ~ 297 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23475

Enviar uma mensagem


QPRT polyclonal antibody (A01)

QPRT polyclonal antibody (A01)