CBX5 purified MaxPab rabbit polyclonal antibody (D01P)
  • CBX5 purified MaxPab rabbit polyclonal antibody (D01P)

CBX5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023468-D01P
CBX5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CBX5 protein.
Información adicional
Size 100 ug
Gene Name CBX5
Gene Alias HP1|HP1A
Gene Description chromobox homolog 5 (HP1 alpha homolog, Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CBX5 (NP_036249.1, 1 a.a. ~ 191 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23468

Enviar uma mensagem


CBX5 purified MaxPab rabbit polyclonal antibody (D01P)

CBX5 purified MaxPab rabbit polyclonal antibody (D01P)