HEY1 monoclonal antibody (M16), clone 3B4
  • HEY1 monoclonal antibody (M16), clone 3B4

HEY1 monoclonal antibody (M16), clone 3B4

Ref: AB-H00023462-M16
HEY1 monoclonal antibody (M16), clone 3B4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant HEY1.
Información adicional
Size 100 ug
Gene Name HEY1
Gene Alias BHLHb31|CHF2|HERP2|HESR1|HRT-1|MGC1274|OAF1
Gene Description hairy/enhancer-of-split related with YRPW motif 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSFGPVLPVVTSASKLSLPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HEY1 (NP_036390, 181 a.a. ~ 288 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23462
Clone Number 3B4
Iso type IgG2a Kappa

Enviar uma mensagem


HEY1 monoclonal antibody (M16), clone 3B4

HEY1 monoclonal antibody (M16), clone 3B4