HEY1 monoclonal antibody (M04), clone 3B2 View larger

Mouse monoclonal antibody raised against a partial recombinant HEY1.

AB-H00023462-M04

New product

HEY1 monoclonal antibody (M04), clone 3B2

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name HEY1
Gene Alias BHLHb31|CHF2|HERP2|HESR1|HRT-1|MGC1274|OAF1
Gene Description hairy/enhancer-of-split related with YRPW motif 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HEY1 (NP_036390, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23462
Clone Number 3B2
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant HEY1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant HEY1.

Mouse monoclonal antibody raised against a partial recombinant HEY1.