ABCA6 monoclonal antibody (M01), clone 2F1
  • ABCA6 monoclonal antibody (M01), clone 2F1

ABCA6 monoclonal antibody (M01), clone 2F1

Ref: AB-H00023460-M01
ABCA6 monoclonal antibody (M01), clone 2F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ABCA6.
Información adicional
Size 100 ug
Gene Name ABCA6
Gene Alias EST155051|FLJ43498
Gene Description ATP-binding cassette, sub-family A (ABC1), member 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NVQFPGMAPQNLGRVDKFNSSSLMVVYTPISNLTQQIMNKTALAPLLKGTSVIGAPNKTHMDEILLENLPYAMGIIFNETFSYKLIFFQGYNSPLWK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ABCA6 (NP_525023, 53 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23460
Clone Number 2F1
Iso type IgG1 Kappa

Enviar uma mensagem


ABCA6 monoclonal antibody (M01), clone 2F1

ABCA6 monoclonal antibody (M01), clone 2F1