SLC35A3 monoclonal antibody (M01), clone 4B6
  • SLC35A3 monoclonal antibody (M01), clone 4B6

SLC35A3 monoclonal antibody (M01), clone 4B6

Ref: AB-H00023443-M01
SLC35A3 monoclonal antibody (M01), clone 4B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC35A3.
Información adicional
Size 100 ug
Gene Name SLC35A3
Gene Alias DKFZp781P1297
Gene Description solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq DSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC35A3 (NP_036375, 61 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23443
Clone Number 4B6
Iso type IgG2a Kappa

Enviar uma mensagem


SLC35A3 monoclonal antibody (M01), clone 4B6

SLC35A3 monoclonal antibody (M01), clone 4B6