OTP monoclonal antibody (M03), clone 8E12
  • OTP monoclonal antibody (M03), clone 8E12

OTP monoclonal antibody (M03), clone 8E12

Ref: AB-H00023440-M03
OTP monoclonal antibody (M03), clone 8E12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant OTP.
Información adicional
Size 100 ug
Gene Name OTP
Gene Alias MGC3161
Gene Description orthopedia homeobox
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDLAPNSDPVEGATLLPGEDITTVGSTPASLAVSAKDPDKQPGPQGGPNPSQAGQQQGQQKQKRHRTRFTPAQLNELE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OTP (NP_115485.1, 11 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23440
Clone Number 8E12
Iso type IgG2a Kappa

Enviar uma mensagem


OTP monoclonal antibody (M03), clone 8E12

OTP monoclonal antibody (M03), clone 8E12