RHOQ purified MaxPab mouse polyclonal antibody (B01P)
  • RHOQ purified MaxPab mouse polyclonal antibody (B01P)

RHOQ purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023433-B01P
RHOQ purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RHOQ protein.
Información adicional
Size 50 ug
Gene Name RHOQ
Gene Alias ARHQ|RASL7A|TC10|TC10A
Gene Description ras homolog gene family, member Q
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RHOQ (NP_036381.2, 1 a.a. ~ 205 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23433

Enviar uma mensagem


RHOQ purified MaxPab mouse polyclonal antibody (B01P)

RHOQ purified MaxPab mouse polyclonal antibody (B01P)