AP4E1 polyclonal antibody (A01)
  • AP4E1 polyclonal antibody (A01)

AP4E1 polyclonal antibody (A01)

Ref: AB-H00023431-A01
AP4E1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant AP4E1.
Información adicional
Size 50 uL
Gene Name AP4E1
Gene Alias DKFZp686L12167
Gene Description adaptor-related protein complex 4, epsilon 1 subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SDDFGKLWLSFANDVKQNVKMSESQAALPSALKTLQQKLRLHIIEIIGNEGLLACQLLPSIPCLLHCRVHADVLALWFRSSCSTLPDYLLYQCQKVMEGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AP4E1 (NP_031373, 1038 a.a. ~ 1137 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23431

Enviar uma mensagem


AP4E1 polyclonal antibody (A01)

AP4E1 polyclonal antibody (A01)