SLC7A8 monoclonal antibody (M01), clone 3F10
  • SLC7A8 monoclonal antibody (M01), clone 3F10

SLC7A8 monoclonal antibody (M01), clone 3F10

Ref: AB-H00023428-M01
SLC7A8 monoclonal antibody (M01), clone 3F10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC7A8.
Información adicional
Size 100 ug
Gene Name SLC7A8
Gene Alias LAT2|LPI-PC1
Gene Description solute carrier family 7 (cationic amino acid transporter, y+ system), member 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC7A8 (NP_036376.2, 467 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23428
Clone Number 3F10
Iso type IgG2a Kappa

Enviar uma mensagem


SLC7A8 monoclonal antibody (M01), clone 3F10

SLC7A8 monoclonal antibody (M01), clone 3F10