ITGB3BP monoclonal antibody (M01), clone 3F6
  • ITGB3BP monoclonal antibody (M01), clone 3F6

ITGB3BP monoclonal antibody (M01), clone 3F6

Ref: AB-H00023421-M01
ITGB3BP monoclonal antibody (M01), clone 3F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITGB3BP.
Información adicional
Size 100 ug
Gene Name ITGB3BP
Gene Alias CENP-R|CENPR|HSU37139|NRIF3|TAP20
Gene Description integrin beta 3 binding protein (beta3-endonexin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGB3BP (AAH14385, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23421
Clone Number 3F6
Iso type IgG2a Kappa

Enviar uma mensagem


ITGB3BP monoclonal antibody (M01), clone 3F6

ITGB3BP monoclonal antibody (M01), clone 3F6