MLYCD purified MaxPab rabbit polyclonal antibody (D01P)
  • MLYCD purified MaxPab rabbit polyclonal antibody (D01P)

MLYCD purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023417-D01P
MLYCD purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MLYCD protein.
Información adicional
Size 100 ug
Gene Name MLYCD
Gene Alias MCD|MGC59795
Gene Description malonyl-CoA decarboxylase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRGFGPGLTARRLLPLRLPPRPPGPRLASGQAAGALERAMDELLRRAVPPTPAYELREKTPAPAEGQCADFVSFYGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGVLHLRQQQREAAVLLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAEAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MLYCD (NP_036345.2, 1 a.a. ~ 493 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23417

Enviar uma mensagem


MLYCD purified MaxPab rabbit polyclonal antibody (D01P)

MLYCD purified MaxPab rabbit polyclonal antibody (D01P)