SIRT1 polyclonal antibody (A01)
  • SIRT1 polyclonal antibody (A01)

SIRT1 polyclonal antibody (A01)

Ref: AB-H00023411-A01
SIRT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SIRT1.
Información adicional
Size 50 uL
Gene Name SIRT1
Gene Alias SIR2L1
Gene Description sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIRT1 (AAH12499, 456 a.a. ~ 555 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23411

Enviar uma mensagem


SIRT1 polyclonal antibody (A01)

SIRT1 polyclonal antibody (A01)