SIRT3 monoclonal antibody (M09), clone 1A4
  • SIRT3 monoclonal antibody (M09), clone 1A4

SIRT3 monoclonal antibody (M09), clone 1A4

Ref: AB-H00023410-M09
SIRT3 monoclonal antibody (M09), clone 1A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SIRT3.
Información adicional
Size 100 ug
Gene Name SIRT3
Gene Alias SIR2L3
Gene Description sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIRT3 (NP_036371.1, 297 a.a. ~ 399 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23410
Clone Number 1A4
Iso type IgG2b Kappa

Enviar uma mensagem


SIRT3 monoclonal antibody (M09), clone 1A4

SIRT3 monoclonal antibody (M09), clone 1A4