SIRT3 MaxPab mouse polyclonal antibody (B02)
  • SIRT3 MaxPab mouse polyclonal antibody (B02)

SIRT3 MaxPab mouse polyclonal antibody (B02)

Ref: AB-H00023410-B02
SIRT3 MaxPab mouse polyclonal antibody (B02)

Información del producto

Mouse polyclonal antibody raised against a full-length human SIRT3 protein.
Información adicional
Size 50 uL
Gene Name SIRT3
Gene Alias SIR2L3
Gene Description sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SIRT3 (NP_001017524.1, 1 a.a. ~ 257 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 23410

Enviar uma mensagem


SIRT3 MaxPab mouse polyclonal antibody (B02)

SIRT3 MaxPab mouse polyclonal antibody (B02)