SIRT4 purified MaxPab mouse polyclonal antibody (B01P)
  • SIRT4 purified MaxPab mouse polyclonal antibody (B01P)

SIRT4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023409-B01P
SIRT4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SIRT4 protein.
Información adicional
Size 50 ug
Gene Name SIRT4
Gene Alias MGC130046|MGC130047|MGC57437|SIR2L4
Gene Description sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SIRT4 (NP_036372.1, 1 a.a. ~ 314 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23409

Enviar uma mensagem


SIRT4 purified MaxPab mouse polyclonal antibody (B01P)

SIRT4 purified MaxPab mouse polyclonal antibody (B01P)