COTL1 polyclonal antibody (A01)
  • COTL1 polyclonal antibody (A01)

COTL1 polyclonal antibody (A01)

Ref: AB-H00023406-A01
COTL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COTL1.
Información adicional
Size 50 uL
Gene Name COTL1
Gene Alias CLP|FLJ43657|MGC19733
Gene Description coactosin-like 1 (Dictyostelium)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COTL1 (NP_066972, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23406

Enviar uma mensagem


COTL1 polyclonal antibody (A01)

COTL1 polyclonal antibody (A01)