DICER1 monoclonal antibody (M01), clone 2F12
  • DICER1 monoclonal antibody (M01), clone 2F12

DICER1 monoclonal antibody (M01), clone 2F12

Ref: AB-H00023405-M01
DICER1 monoclonal antibody (M01), clone 2F12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DICER1.
Información adicional
Size 50 ug
Gene Name DICER1
Gene Alias DCR1|Dicer|HERNA|KIAA0928
Gene Description dicer 1, ribonuclease type III
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DICER1 (NP_803187, 1813 a.a. ~ 1912 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23405
Clone Number 2F12
Iso type IgG1 Kappa

Enviar uma mensagem


DICER1 monoclonal antibody (M01), clone 2F12

DICER1 monoclonal antibody (M01), clone 2F12