FBXO46 polyclonal antibody (A01)
  • FBXO46 polyclonal antibody (A01)

FBXO46 polyclonal antibody (A01)

Ref: AB-H00023403-A01
FBXO46 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FBXO46.
Información adicional
Size 50 uL
Gene Name FBXO46
Gene Alias 20D7-FC4|FBXO34L|Fbx46
Gene Description F-box protein 46
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VALVEQRAALALQSYPRPTTPAPVVFVSAEQGGPAKGVGSERRSGGGDCSRVAEAVAHFEAQRDSPPTKGLRKEERPGPGPGEVRIAFRISNGREPRAPD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXO46 (XP_371179, 176 a.a. ~ 275 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23403

Enviar uma mensagem


FBXO46 polyclonal antibody (A01)

FBXO46 polyclonal antibody (A01)