ATP13A2 polyclonal antibody (A01)
  • ATP13A2 polyclonal antibody (A01)

ATP13A2 polyclonal antibody (A01)

Ref: AB-H00023400-A01
ATP13A2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ATP13A2.
Información adicional
Size 50 uL
Gene Name ATP13A2
Gene Alias FLJ26510|HSA9947|KRPPD|PARK9
Gene Description ATPase type 13A2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATP13A2 (NP_071372, 68 a.a. ~ 154 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23400

Enviar uma mensagem


ATP13A2 polyclonal antibody (A01)

ATP13A2 polyclonal antibody (A01)