LARS2 monoclonal antibody (M03), clone 3F12
  • LARS2 monoclonal antibody (M03), clone 3F12

LARS2 monoclonal antibody (M03), clone 3F12

Ref: AB-H00023395-M03
LARS2 monoclonal antibody (M03), clone 3F12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LARS2.
Información adicional
Size 100 ug
Gene Name LARS2
Gene Alias KIAA0028|LEURS|MGC26121
Gene Description leucyl-tRNA synthetase 2, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq VPRKLCAHYTWDASVLLQAWPAVDPEFLQQPEVVQMAVLINNKACGKIPVPQQVARDQDKVHEFVLQSELGVRLLQGRSIKKSFLSPRTALINFLVQD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LARS2 (NP_056155, 806 a.a. ~ 903 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23395
Clone Number 3F12
Iso type IgG2a Kappa

Enviar uma mensagem


LARS2 monoclonal antibody (M03), clone 3F12

LARS2 monoclonal antibody (M03), clone 3F12