LARS2 purified MaxPab mouse polyclonal antibody (B01P)
  • LARS2 purified MaxPab mouse polyclonal antibody (B01P)

LARS2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023395-B01P
LARS2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LARS2 protein.
Información adicional
Size 50 ug
Gene Name LARS2
Gene Alias KIAA0028|LEURS|MGC26121
Gene Description leucyl-tRNA synthetase 2, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASVWQRLGFYASLLKRQLNGGPDVIKWERRVIPGCTRSIYSATGKWTKEYTLQTRKDVEKWWHQRIKEQASKISEADKSKPKFYVLSMFPYPSGKLHMGHVRVYTISDTIARFQKMRGMQVINPMGWDAFGLPAENAAVERNLHPQSWTQSNIKHMRKQLDRLGLCFSWDREITTCLPDYYKWTQYLFIKLYEAGLAYQKEALVNWDPVDQTVLANEQVDEHGCSWRSGAKVEQKYLRQWFIKTTAYAKAMQDA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LARS2 (NP_056155.1, 1 a.a. ~ 903 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23395

Enviar uma mensagem


LARS2 purified MaxPab mouse polyclonal antibody (B01P)

LARS2 purified MaxPab mouse polyclonal antibody (B01P)