MED13L monoclonal antibody (M01), clone 4H2
  • MED13L monoclonal antibody (M01), clone 4H2

MED13L monoclonal antibody (M01), clone 4H2

Ref: AB-H00023389-M01
MED13L monoclonal antibody (M01), clone 4H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MED13L.
Información adicional
Size 100 ug
Gene Name MED13L
Gene Alias DKFZp781D0112|FLJ21627|KIAA1025|PROSIT240|THRAP2|TRAP240L
Gene Description mediator complex subunit 13-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IFGKNSDIGQAAERRLMMCQSTFLPQVEGTKKPQEPPISLLLLLQNQHTQPFASLNFLDYISSNNRQTLPCVSWSYDRVQADNNDYWTECFNALEQGRQY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MED13L (NP_056150, 1186 a.a. ~ 1285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23389
Clone Number 4H2
Iso type IgG2a Kappa

Enviar uma mensagem


MED13L monoclonal antibody (M01), clone 4H2

MED13L monoclonal antibody (M01), clone 4H2