THRAP2 polyclonal antibody (A01)
  • THRAP2 polyclonal antibody (A01)

THRAP2 polyclonal antibody (A01)

Ref: AB-H00023389-A01
THRAP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant THRAP2.
Información adicional
Size 50 uL
Gene Name MED13L
Gene Alias DKFZp781D0112|FLJ21627|KIAA1025|PROSIT240|THRAP2|TRAP240L
Gene Description mediator complex subunit 13-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IFGKNSDIGQAAERRLMMCQSTFLPQVEGTKKPQEPPISLLLLLQNQHTQPFASLNFLDYISSNNRQTLPCVSWSYDRVQADNNDYWTECFNALEQGRQY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen THRAP2 (NP_056150, 1186 a.a. ~ 1285 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23389

Enviar uma mensagem


THRAP2 polyclonal antibody (A01)

THRAP2 polyclonal antibody (A01)