NCSTN monoclonal antibody (M01), clone 1E8
  • NCSTN monoclonal antibody (M01), clone 1E8

NCSTN monoclonal antibody (M01), clone 1E8

Ref: AB-H00023385-M01
NCSTN monoclonal antibody (M01), clone 1E8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NCSTN.
Información adicional
Size 100 ug
Gene Name NCSTN
Gene Alias APH2|KIAA0253
Gene Description nicastrin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NCSTN (AAH47621, 16 a.a. ~ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23385
Clone Number 1E8
Iso type IgG2a Kappa

Enviar uma mensagem


NCSTN monoclonal antibody (M01), clone 1E8

NCSTN monoclonal antibody (M01), clone 1E8