NCSTN polyclonal antibody (A01)
  • NCSTN polyclonal antibody (A01)

NCSTN polyclonal antibody (A01)

Ref: AB-H00023385-A01
NCSTN polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NCSTN.
Información adicional
Size 50 uL
Gene Name NCSTN
Gene Alias APH2|KIAA0253
Gene Description nicastrin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NCSTN (AAH47621, 16 a.a. ~ 115 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23385

Enviar uma mensagem


NCSTN polyclonal antibody (A01)

NCSTN polyclonal antibody (A01)