ARHGEF18 monoclonal antibody (M01), clone 8H6
  • ARHGEF18 monoclonal antibody (M01), clone 8H6

ARHGEF18 monoclonal antibody (M01), clone 8H6

Ref: AB-H00023370-M01
ARHGEF18 monoclonal antibody (M01), clone 8H6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ARHGEF18.
Información adicional
Size 100 ug
Gene Name ARHGEF18
Gene Alias KIAA0521|MGC15913|P114-RhoGEF
Gene Description rho/rac guanine nucleotide exchange factor (GEF) 18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSQGMQRMHLETLQQVDKWPLCGPLACSELLQLTVRSLEGWRKEVLGSIKGAGTSQGGEIHPRSSSGGERAHVKPCSAPQALVVGLGPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARHGEF18 (AAH08016.1, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23370
Clone Number 8H6
Iso type IgG2a Kappa

Enviar uma mensagem


ARHGEF18 monoclonal antibody (M01), clone 8H6

ARHGEF18 monoclonal antibody (M01), clone 8H6