SYNE1 polyclonal antibody (A01)
  • SYNE1 polyclonal antibody (A01)

SYNE1 polyclonal antibody (A01)

Ref: AB-H00023345-A01
SYNE1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SYNE1.
Información adicional
Size 50 uL
Gene Name SYNE1
Gene Alias 8B|CPG2|DKFZp781J13156|FLJ30878|FLJ41140|KIAA0796|KIAA1262|KIAA1756|MYNE1|SCAR8
Gene Description spectrin repeat containing, nuclear envelope 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVVNRDSCVQEAAALQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SYNE1 (NP_892006, 1561 a.a. ~ 1670 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23345

Enviar uma mensagem


SYNE1 polyclonal antibody (A01)

SYNE1 polyclonal antibody (A01)