CLASP1 monoclonal antibody (M02), clone 6A11
  • CLASP1 monoclonal antibody (M02), clone 6A11

CLASP1 monoclonal antibody (M02), clone 6A11

Ref: AB-H00023332-M02
CLASP1 monoclonal antibody (M02), clone 6A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CLASP1.
Información adicional
Size 100 ug
Gene Name CLASP1
Gene Alias DKFZp686D1968|DKFZp686H2039|FLJ33821|FLJ41222|KIAA0622|MAST1|MGC131895
Gene Description cytoplasmic linker associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFSFRSQEDLNEPIKRDGKKECDIVSRDGGAASPAT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLASP1 (NP_056097, 1133 a.a. ~ 1226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23332
Clone Number 6A11
Iso type IgG1 Kappa

Enviar uma mensagem


CLASP1 monoclonal antibody (M02), clone 6A11

CLASP1 monoclonal antibody (M02), clone 6A11