SASH1 monoclonal antibody (M02), clone X1
  • SASH1 monoclonal antibody (M02), clone X1

SASH1 monoclonal antibody (M02), clone X1

Ref: AB-H00023328-M02
SASH1 monoclonal antibody (M02), clone X1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SASH1.
Información adicional
Size 100 ug
Gene Name SASH1
Gene Alias KIAA0790|RP3-323M4.1|SH3D6A|dJ323M4|dJ323M4.1
Gene Description SAM and SH3 domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ENTSLQEHGVKLGPALTRKVSCARGVDLETLTENKLHAEGIDLTEEPYSDKHGRCGIPEALVQRYAEDLDQPERDVAANMDQIRVKQLRKQHRMAIPSGGLTEICRKPVS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SASH1 (NP_056093, 1066 a.a. ~ 1175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23328
Clone Number X1
Iso type IgG1 Kappa

Enviar uma mensagem


SASH1 monoclonal antibody (M02), clone X1

SASH1 monoclonal antibody (M02), clone X1