SASH1 polyclonal antibody (A01)
  • SASH1 polyclonal antibody (A01)

SASH1 polyclonal antibody (A01)

Ref: AB-H00023328-A01
SASH1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SASH1.
Información adicional
Size 50 uL
Gene Name SASH1
Gene Alias KIAA0790|RP3-323M4.1|SH3D6A|dJ323M4|dJ323M4.1
Gene Description SAM and SH3 domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ENTSLQEHGVKLGPALTRKVSCARGVDLETLTENKLHAEGIDLTEEPYSDKHGRCGIPEALVQRYAEDLDQPERDVAANMDQIRVKQLRKQHRMAIPSGGLTEICRKPVS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SASH1 (NP_056093, 1066 a.a. ~ 1175 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23328

Enviar uma mensagem


SASH1 polyclonal antibody (A01)

SASH1 polyclonal antibody (A01)