CUX2 monoclonal antibody (M03), clone 2H8
  • CUX2 monoclonal antibody (M03), clone 2H8

CUX2 monoclonal antibody (M03), clone 2H8

Ref: AB-H00023316-M03
CUX2 monoclonal antibody (M03), clone 2H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CUX2.
Información adicional
Size 100 ug
Gene Name CUX2
Gene Alias CDP2|CUTL2
Gene Description cut-like homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CUX2 (NP_056082.1, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23316
Clone Number 2H8
Iso type IgG1 Kappa

Enviar uma mensagem


CUX2 monoclonal antibody (M03), clone 2H8

CUX2 monoclonal antibody (M03), clone 2H8