ICOSLG monoclonal antibody (M01), clone 1E2
  • ICOSLG monoclonal antibody (M01), clone 1E2

ICOSLG monoclonal antibody (M01), clone 1E2

Ref: AB-H00023308-M01
ICOSLG monoclonal antibody (M01), clone 1E2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ICOSLG.
Información adicional
Size 100 ug
Gene Name ICOSLG
Gene Alias B7-H2|B7H2|B7RP-1|B7RP1|CD275|GL50|ICOS-L|ICOSL|KIAA0653|LICOS
Gene Description inducible T-cell co-stimulator ligand
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ICOSLG (AAH64637, 20 a.a. ~ 302 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23308
Clone Number 1E2
Iso type IgG1 kappa

Enviar uma mensagem


ICOSLG monoclonal antibody (M01), clone 1E2

ICOSLG monoclonal antibody (M01), clone 1E2