UBR2 MaxPab rabbit polyclonal antibody (D01)
  • UBR2 MaxPab rabbit polyclonal antibody (D01)

UBR2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00023304-D01
UBR2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human UBR2 protein.
Información adicional
Size 100 uL
Gene Name UBR2
Gene Alias C6orf133|DKFZp686C08114|KIAA0349|MGC71112|RP3-392M17.3|bA49A4.1|dJ242G1.1|dJ392M17.3
Gene Description ubiquitin protein ligase E3 component n-recognin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHELNTSEIEEEEDPLVHLSEDVIARTYNIFAITFRYAVEILTWEKESELPADLEMVEKSDTYYCMLFNDEVHTYEQVIYTLQKAVNCTQK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBR2 (AAH64512.1, 1 a.a. ~ 439 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 23304

Enviar uma mensagem


UBR2 MaxPab rabbit polyclonal antibody (D01)

UBR2 MaxPab rabbit polyclonal antibody (D01)