UBR2 polyclonal antibody (A01)
  • UBR2 polyclonal antibody (A01)

UBR2 polyclonal antibody (A01)

Ref: AB-H00023304-A01
UBR2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UBR2.
Información adicional
Size 50 uL
Gene Name UBR2
Gene Alias C6orf133|DKFZp686C08114|KIAA0349|MGC71112|RP3-392M17.3|bA49A4.1|dJ242G1.1|dJ392M17.3
Gene Description ubiquitin protein ligase E3 component n-recognin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBR2 (NP_056070, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23304

Enviar uma mensagem


UBR2 polyclonal antibody (A01)

UBR2 polyclonal antibody (A01)