DNMBP purified MaxPab rabbit polyclonal antibody (D01P)
  • DNMBP purified MaxPab rabbit polyclonal antibody (D01P)

DNMBP purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023268-D01P
DNMBP purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DNMBP protein.
Información adicional
Size 100 ug
Gene Name DNMBP
Gene Alias KIAA1010|TUBA
Gene Description dynamin binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MTLLSSQSSSLVAPSGSVSAENPEQRMLEKRAKVIEELLQTERDYIRDLEMCIERIMVPMQQAQVPNIDFEGLFGNTQMVIKVSKQLLAALEISDAVGPVFLGHRDELEGTYKIYCQNHDEAIALLEIYEKDEKIQKHLQDSLADLKSLYNEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEINVNINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVSSHLK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DNMBP (AAH41628.1, 1 a.a. ~ 823 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23268

Enviar uma mensagem


DNMBP purified MaxPab rabbit polyclonal antibody (D01P)

DNMBP purified MaxPab rabbit polyclonal antibody (D01P)