PDS5A purified MaxPab mouse polyclonal antibody (B01P)
  • PDS5A purified MaxPab mouse polyclonal antibody (B01P)

PDS5A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023244-B01P
PDS5A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PDS5A protein.
Información adicional
Size 50 ug
Gene Name PDS5A
Gene Alias DKFZp686B19246|FLJ41012|KIAA0648|MGC131948|MGC161503|PIG54|SCC-112
Gene Description PDS5, regulator of cohesion maintenance, homolog A (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MIHLLAHDPDFTRSQDVDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCDVALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPAGVLGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAAETGVSENEENPVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDS5A (AAH09650.1, 1 a.a. ~ 333 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23244

Enviar uma mensagem


PDS5A purified MaxPab mouse polyclonal antibody (B01P)

PDS5A purified MaxPab mouse polyclonal antibody (B01P)